You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579494 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to B3galt2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49kDa |
Target | B3galt2 |
UniProt ID | O54905 |
Protein Sequence | Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK |
NCBI | NP_064409 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: B3GALT2, Sample Tissue: Mouse NIH 373 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Adult mouse cortex, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: B3Galt2 Cyan: Nissl(Neurons), Gene Name: B3galt2.
WB Suggested Anti-B3galt2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Mouse Brain.
ELISA, IF, IHC-P | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating