You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295607 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant B2M.This product is belong to Cell Culture Grade Antibody (CX Grade). |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3F9-2C2 |
Tested applications | ELISA, IF, IHC-P, PLA, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | B2M (AAH32589.1, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
NCBI | AAH32589.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
B2M monoclonal antibody (M01J), clone 3F9-2C2. Western Blot analysis of B2M expression in U-2 OS.
Detection limit for recombinant GST tagged B2M is 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml].
Proximity Ligation Analysis of protein-protein interactions between CALR and B2M. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and anti-B2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody (M01J), clone 3F9-2C2. Lane 1: B2M transfected lysate (Predicted MW: 13.7 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody (M01), clone 3F9-2C2 (Cat # orb2295608). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (38.83 KDa).
Filter by Rating