B2M monoclonal antibody (M01), clone 3F9-2C2

• Catalog Number: orb2295608
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant B2M.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F9-2C2
• Tested applications: ELISA, IF, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: B2M (AAH32589, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• NCBI: AAH32589
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

B2M monoclonal antibody (M01), clone 3F9-2C2 Western Blot analysis of B2M expression in U-2 OS.

Detection limit for recombinant GST tagged B2M is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CALR and B2M. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and anti-B2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody (M01), clone 3F9-2C2. Lane 1: B2M transfected lysate(13.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody (M01), clone 3F9-2C2 (Cat # orb2295608). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (38.83 KDa).