AXUD1 antibody

• Catalog Number: orb583670
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AXUD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AXUD1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: CSRNP1
• UniProt ID: D6RBU1
• Protein Sequence: Synthetic peptide located within the following region: ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK
• NCBI: NP_149016
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AXUD1, URAX1, TAIP-3, CSRNP-1, FAM130B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: CSRNP1, Positive control (+): Human Fetal Heart (HE), Negative control (-): 293T cell lysate (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-AXUD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.