ATP7A antibody

• Catalog Number: orb579085
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP7A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP7A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: ATP7A
• UniProt ID: Q04656
• Protein Sequence: Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MK, MNK, DSMAX, SMAX3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ATP7A, Sample Type: Fetal Liver lysates, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ATP7B, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: ATP7B, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: ATP7B, Sample Tissue: Human NCI-H226 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: ATP7B, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 3 ug/ml.