You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579396 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP6V0C |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16 kDa |
Target | ATP6V0C |
UniProt ID | P27449 |
Protein Sequence | Synthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG |
NCBI | NP_001685 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ATPL, VATL, VPPC, Vma3, ATP6C, ATP6L Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated whole cell extracts was loaded onto a 10-20% gradient SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended antibody dilution is 1 ug/ml to 3 ug/ml.
Host: Rabbit, Target Name: ATP6V0C, Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: ATP6V0C, Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: ATP6V0C, Sample Type: ACHN, Antibody Dilution: 1.0 ug/ml. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.
Host: Rabbit, Target Name: ATP6V0C, Sample Type: Human Lung, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: ATP6V0C, Positive control (+): RPMI-8226 (N12), Negative control (-): U937 (N31), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ATP6V0C Antibody Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate. ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.
WB | |
Bovine, C. elegans, Drosophila, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating