You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578447 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP6V0A2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 98kDa |
Target | ATP6V0A2 |
UniProt ID | Q9Y487 |
Protein Sequence | Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
NCBI | NP_036595 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-ATP6V0A2 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-ATP6V0A2 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Application: IHC/Immunofluorescence, Species+tissue/cell type: A. untransfected HeLa cells, B. mATP6V0A2-FLAG transfected HeLa cells, C. mATP6V0A2 (partial) transfected HeLa cells, Primary antibody dilution: 1:250, Secondary antibody: Anti-rabbit AlexaFluor 488, Secondary antibody dilution: 1:1000.
Application: Western blotting, Species+tissue/cell type: HeLa cells, How many ug'sof tissue/cell lysate run on the gel: 1. 10 ug untransfected HeLa lysate, 2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate, 3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate, 4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-HRP, Secondary antibody dilution: 1:1000.
ATP6V0A2 antibody - N-terminal region (orb578447) validated by WB using HeLa cells at 1:300.
Host: Rabbit, Target: ATP6V0A2, Positive control (+): MCF7 (N10), Negative control (-): HEK293 (HEK293), Antibody concentration: 1 ug/ml.
Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody (orb578447).
IF, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating