You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579822 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP6V0A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V0A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 87 kDa |
Target | ATP6V0A1 |
UniProt ID | Q93050 |
Protein Sequence | Synthetic peptide located within the following region: RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE |
NCBI | NP_005168 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | a1, Stv1, VPP1, Vph1, ATP6N1, ATP6N1A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical isoform for this protein is 96 kDa, but there are dozens of isoforms with small size differences that contain the peptide sequence. These samples seem to express an 87 kDa isoform 16.
WB Suggested Anti-ATP6V0A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
IHC, WB | |
Bovine, Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating