You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580322 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP5F1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ATP5B |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57 kDa |
Target | ATP5F1B |
UniProt ID | P06576 |
Protein Sequence | Synthetic peptide located within the following region: MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH |
NCBI | NP_001677 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ATP5B, ATPMB, ATPSB, HEL-S-271 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.
ATP5B antibody - C-terminal region (orb580322) validated by WB using 1. Human NT-2 cells (60 ug), 2. and 3. mouse brain extracts (80 ug), 4. rat brain extract (80 ug) at 2 ug/ml.
ATP5B antibody - C-terminal region (orb580322) validated by WB using HepG2 cell lysate at 1.25 ug/ml.
Sample Type: NT2 cells Red: Antibody Blue: DAPI Primary dilution: 1 ug/50 ul antibody Secondary Antibody: Alexa goat anti-rabbit 594.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Yeast, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, IF, IHC, WB | |
Canine, Human, Monkey, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating