ATP1B1 antibody

• Catalog Number: orb330385
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP1B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP1B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: ATP1B1
• UniProt ID: P05026
• Protein Sequence: Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
• NCBI: NP_001001787
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ATP1B antibody, anti MGC1798 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using ATP1B1 antibody

Immunohistochemical staining of human Heart tissue using ATP1B1 antibody

Host: Rat, Target Name: ATP1B1, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Human Heart

WB Suggested Anti-ATP1B1 Antibody Titration: 0.25 ug/mL, Positive Control: HepG2 cell lysate, ATP1B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.