You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330385 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP1B1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATP1B1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | ATP1B1 |
UniProt ID | P05026 |
Protein Sequence | Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |
NCBI | NP_001001787 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ATP1B antibody, anti MGC1798 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HepG2 cell lysate tissue using ATP1B1 antibody
Immunohistochemical staining of human Heart tissue using ATP1B1 antibody
Host: Rat, Target Name: ATP1B1, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
Human Heart
WB Suggested Anti-ATP1B1 Antibody Titration: 0.25 ug/mL, Positive Control: HepG2 cell lysate, ATP1B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating