You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579227 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Atp11c |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 129kDa |
Target | Atp11c |
UniProt ID | Q9QZW0 |
Protein Sequence | Synthetic peptide located within the following region: GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH |
NCBI | NP_001032952 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | I, Ig, AI315324, A330005H02Rik Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Atp11c Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Brain.
Filter by Rating