ATIC antibody

• Catalog Number: orb330467
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATIC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATIC
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: ATIC
• UniProt ID: P31939
• Protein Sequence: Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG
• NCBI: NP_004035
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AICAR antibody, anti AICARFT antibody, anti I
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human, Hamster tissue using ATIC antibody

Western blot analysis of HepG2 cell lysate tissue using ATIC antibody

Sample Type: 1. Hamster CHO K1 cells (20 ug), 2. HeLa skin cells(20 ug), 3. HEK273 cells (20 ug), 4. Human Skin Fibroblats (100 ug), Primary Dilution: 1:800, Secondary Antibody: Clean-Blot IP detection Reagent and Kit, Secondary Dilution: 1:2000.

WB Suggested Anti-ATIC Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, ATIC is supported by BioGPS gene expression data to be expressed in HepG2.