ATIC antibody

• Catalog Number: orb330466
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATIC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATIC
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: ATIC
• UniProt ID: P31939
• Protein Sequence: Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT
• NCBI: EAW70527
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AICAR antibody, anti AICARFT antibody, anti F
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Jurkat tissue using ATIC antibody

Immunohistochemical staining of human kidney tissue using ATIC antibody

ATIC antibody - middle region (orb330466) validated by WB using Jurkat cell lysate at 5.0 ug/mL. ATIC is supported by BioGPS gene expression data to be expressed in Jurkat.

Human kidney