You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330466 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATIC |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATIC |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 30kDa |
Target | ATIC |
UniProt ID | P31939 |
Protein Sequence | Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT |
NCBI | EAW70527 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AICAR antibody, anti AICARFT antibody, anti F Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Jurkat tissue using ATIC antibody
Immunohistochemical staining of human kidney tissue using ATIC antibody
ATIC antibody - middle region (orb330466) validated by WB using Jurkat cell lysate at 5.0 ug/mL. ATIC is supported by BioGPS gene expression data to be expressed in Jurkat.
Human kidney
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating