ATF4 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295739
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ATF4 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human
• Immunogen: ATF4 (NP_001666.2, 1 a.a. ~ 351 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
• NCBI: NP_001666.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Proximity Ligation Analysis of protein-protein interactions between ATF4 and CREBBP. HeLa cells were stained with anti-ATF4 rabbit purified polyclonal 1:1200 and anti-CREBBP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 MaxPab polyclonal antibody. Lane 1: ATF4 transfected lysate(38.60 KDa). Lane 2: Non-transfected lysate.