You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576510 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Atf4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Rat, Sheep |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38kDa |
Target | Atf4 |
UniProt ID | Q5U4B2 |
Protein Sequence | Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP |
NCBI | NP_033846 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAX Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-ATF4 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Atf4 antibody - N-terminal region (orb576510) validated by WB using Mouse Kidney at 0.2-1 ug/ml.
Host: Mouse, Target Name: ATF4, Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: ATF4, Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Kidney.
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IHC-P, WB | |
Mouse | |
Human, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating