You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574956 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATF2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ATF2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | ATF2 |
UniProt ID | P15336 |
Protein Sequence | Synthetic peptide located within the following region: LRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTE |
NCBI | NP_001871 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HB16, CREB2, TREB7, CREB-2, CRE-BP1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: ATF2, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Human Intestine
Human kidney
Rabbit Anti-ATF2 Antibody, Catalog Number: orb574956, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ATF2 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
FC, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating