You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb150777 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal to Ataxin 1 (Biotin). Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | S76-8 |
Tested applications | ICC, IHC, IP, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2b |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Concentration | 1 mg/ml |
Dilution range | WB (1:1000), ICC/IF (1:100) |
Conjugation | Biotin |
MW | 85kDa |
Target | Ataxin 1 |
Entrez | 20238 |
UniProt ID | P54254 |
NCBI | NP_001186233.1 |
Storage | Conjugated antibodies should be stored at 4°C |
Buffer/Preservatives | PBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated |
Alternative names | Ataxin-1 antibody, ATX1 antibody, Atxn1 antibody, Read more... |
Note | For research use only |
Application notes | 1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody. |
Expiration Date | 12 months from date of receipt. |
FC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Bovine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating