You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578495 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASPN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ASPN |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43 kDa |
Target | ASPN |
UniProt ID | Q5TBF3 |
Protein Sequence | Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK |
NCBI | NP_060150 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | OS3, PLAP1, PLAP-1, SLRR1C Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. ASPN is 43 kDa as a full length protein that is cleaved to ~38 kDa. A smaller isoform of 18-20 kDa is also detected. The mature form is also N-linked glycosylated.
Host: Rabbit, Target Name: ASPN, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Host: Rabbit, Target: ASPN, Positive control (+): Lung tumor (T-LU), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.
Human Muscle
WB Suggested Anti-ASPN Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.
Filter by Rating