You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb308773 |
---|---|
Category | Antibodies |
Description | Aspartate beta hydroxylase/ASPH Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 85863 MW |
UniProt ID | Q12797 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Aspartyl/asparaginyl beta-hydroxylase;1.14.11.16 ; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HeLa cells using anti-ASPH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U87 cells using anti-ASPH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of ASPH using anti-ASPH antibody.Lane 1:Rat Brain Tissue;2:Rat Liver Tissue;3:HELA Cell;4:HEPG2 Cell;5:HEPA Cell.
IHC analysis of ASPH using anti-ASPH antibody.ASPH was detected in paraffin-embedded section of Human Mammary Cancer Tissue.
IHC analysis of ASPH using anti-ASPH antibody.ASPH was detected in immunocytochemical section of A549 cell.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating