Cart summary

You have no items in your shopping cart.

    Aspartate beta hydroxylase/ASPH Antibody

    Catalog Number: orb308773

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb308773
    CategoryAntibodies
    DescriptionAspartate beta hydroxylase/ASPH Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW85863 MW
    UniProt IDQ12797
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesAspartyl/asparaginyl beta-hydroxylase;1.14.11.16 ;
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Aspartate beta hydroxylase/ASPH Antibody

    Flow Cytometry analysis of HeLa cells using anti-ASPH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Aspartate beta hydroxylase/ASPH Antibody

    Flow Cytometry analysis of U87 cells using anti-ASPH antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Aspartate beta hydroxylase/ASPH Antibody

    WB analysis of ASPH using anti-ASPH antibody.Lane 1:Rat Brain Tissue;2:Rat Liver Tissue;3:HELA Cell;4:HEPG2 Cell;5:HEPA Cell.

    Aspartate beta hydroxylase/ASPH Antibody

    IHC analysis of ASPH using anti-ASPH antibody.ASPH was detected in paraffin-embedded section of Human Mammary Cancer Tissue.

    Aspartate beta hydroxylase/ASPH Antibody

    IHC analysis of ASPH using anti-ASPH antibody.ASPH was detected in immunocytochemical section of A549 cell.

    • Human ASPH ELISA Kit [orb777401]

      Human

      0.16-10 ng/mL

      0.057 ng/mL

      96 Test, 48 Test, 24 t
    • ASPH antibody [orb155743]

      ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

      Bovine, Equine, Gallus, Human, Mouse, Rabbit, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars