Cart summary

You have no items in your shopping cart.

    ASGR1 antibody

    Catalog Number: orb574829

    DispatchUsually dispatched within 3-7 working days
    $ 537.00
    Catalog Numberorb574829
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to ASGR1
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityAnimal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast
    ReactivityAnimal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast
    ImmunogenThe immunogen is a synthetic peptide directed towards the middlel region of human ASGR1
    Concentration1.0 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW33 kDa
    TargetASGR1
    UniProt IDP07306
    Protein SequenceSynthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
    NCBINP_001662
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesHL-1, ASGPR, ASGPR1, CLEC4H1
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    ASGR1 antibody

    25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be glycosylated and/or lipidated.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target Name: ASGR1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

    ASGR1 antibody

    Host: Rabbit, Target: ASGR1, Positive control (+): Human brain (BR), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

    ASGR1 antibody

    WB Suggested Antibody Titration: 0.2-1 ug/ml, Positive Control: Liver.

    • ASGR1 antibody [orb574828]

      WB

      Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast

      Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • ASGR1 Antibody [orb1243482]

      ELISA,  WB

      Canine, Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • ASGR1 Antibody [orb1243483]

      ELISA,  WB

      Canine, Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • ASGR1 antibody [orb4635]

      ELISA,  IHC-P,  WB

      Bovine, Equine, Human, Mouse, Porcine, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 200 μg
    • ASGR1 antibody [orb520292]

      ELISA,  IHC,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μl, 100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars