ASGR1 antibody

• Catalog Number: orb574828
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASGR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast
• Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ASGR1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33 kDa
• Target: ASGR1
• UniProt ID: P07306
• Protein Sequence: Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
• NCBI: NP_001662
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HL-1, ASGPR, ASGPR1, CLEC4H1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2.

Host: Rabbit, Target Name: ASGR1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ASGR1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target: ASGR1, Positive control (+): Human brain (BR), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ASGR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.