You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574828 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASGR1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast |
Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ASGR1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33 kDa |
Target | ASGR1 |
UniProt ID | P07306 |
Protein Sequence | Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS |
NCBI | NP_001662 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HL-1, ASGPR, ASGPR1, CLEC4H1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target Name: ASGR1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: ASGR1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: ASGR1, Positive control (+): Human brain (BR), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ASGR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.
WB | |
Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast | |
Animal, Bovine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Bovine, Equine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating