You have no items in your shopping cart.
Cart summary
ASAH1 Protein, Mouse, Recombinant (GST & His & Myc)
Catalog Number: orb1977430
| Catalog Number | orb1977430 |
|---|---|
| Category | Proteins |
| Description | ASAH1 Protein, Mouse, Recombinant (GST & His & Myc) is expressed in E. coli expression system with N-10XHis-GST and C-Myc tag. The predicted molecular weight is 43.8 kDa and the accession number is Q9WV54. |
| Tag | N-10XHis-GST, C-Myc |
| Purity | 98.00% |
| MW | 43.8 kDa (predicted) |
| UniProt ID | Q9WV54 |
| Protein Sequence | QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | ASAH1 Protein, Mouse, Recombinant (GST & His & Myc) is expressed in E. coli expression system with N-10XHis-GST and C-Myc tag. The predicted molecular weight is 43.8 kDa and the accession number is Q9WV54. |
| Expression Region | 19-141 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
