You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583701 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ASAH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ASAH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | ASAH1 |
UniProt ID | Q13510 |
Protein Sequence | Synthetic peptide located within the following region: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP |
NCBI | NP_808592 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AC, PHP, ASAH, PHP32, ACDase, SMAPME Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rat, Target Name: ASAH1, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.
Rabbit Anti-ASAH1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Lung, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-ASAH1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-ASAH1 Antibody, Catalog Number: orb583701, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in lysosomes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ASAH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.
ELISA, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating