ARNTL Rabbit Polyclonal Antibody

• Catalog Number: orb574008
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARNTL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARNTL
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: ARNTL
• UniProt ID: O00327
• Protein Sequence: Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
• NCBI: NP_001169
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TIC, JAP3, MOP3, BMAL1, PASD3, BMAL1c, bHLHe5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Human Skin

WB Suggested Anti-ARNTL Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.