You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330698 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARL13B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARL13B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48 kDa |
Target | ARL13B |
UniProt ID | Q8TCL5 |
Protein Sequence | Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK |
NCBI | NP_659433 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARL2L1 antibody, anti DKFZp686E2075 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The 49 kDa peptide is also present in 37 kDa isoforms. The protein may be modified by lipidation and/or sumoylation.
Host: Rabbit, Target Name: ARL13B, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: ARL13B, Positive control (+): Lung tumor (T-LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ARL13B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating