Arih2 antibody

• Catalog Number: orb583782
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Arih2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Arih2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: Arih2
• UniProt ID: D3ZJB8
• Protein Sequence: Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ
• NCBI: NP_001012275
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ARI2, TRIAD1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: Arih2, Sample Type: Rat Testis lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-Arih2 Antibody, Catalog Number: orb583782, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-Arih2 antibody Titration: 1 ug/ml, Sample Type: Human heart.