ARIH2 antibody

• Catalog Number: orb575075
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARIH2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARIH2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: ARIH2
• UniProt ID: O95376
• Protein Sequence: Synthetic peptide located within the following region: EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL
• NCBI: NP_006312
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ARI2, TRIAD1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ARIH2, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml. Peptide Concentration: 1.0 ug/ml. Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that ARIH2 is expressed in Jurkat.

Human Lung

WB Suggested Anti-ARIH2 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that ARIH2 is expressed in Jurkat.