Cart summary

You have no items in your shopping cart.

    ARHGAP27 Peptide - middle region

    ARHGAP27 Peptide - middle region

    Catalog Number: orb2002504

    DispatchUsually dispatched within 5-10 working days
    $ 284.00
    Catalog Numberorb2002504
    CategoryProteins
    DescriptionThis is a synthetic peptide designed for use in combination with anti-RHG27 Antibody (ARP67368_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
    Tested applicationsWB
    Form/AppearanceLyophilized powder
    MW94kDa
    UniProt IDQ6ZUM4
    Protein SequenceSynthetic peptide located within the following region: SQDKQMLYTNHFTQEQVPVPAPRSIHKSSQDGDTPAQASPPEEKVPAELD
    StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
    Buffer/PreservativesLyophilized powder
    Alternative namesPP905, SH3D20, SH3P20, CAMGAP1
    Read more...
    NoteFor research use only
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars