ARG2 antibody

• Catalog Number: orb582384
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARG2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARG2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: ARG2
• UniProt ID: P78540
• Protein Sequence: Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
• NCBI: NP_001163
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ARG2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb582384 with 1:200 dilution. Western blot was performed using orb582384 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: ARG2 IP with orb582384 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Mouse, Target Name: ARG2, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: ARG2, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target: ARG2, Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-ARG2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. ARG2 is supported by BioGPS gene expression data to be expressed in Jurkat.