You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582398 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARF6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARF6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 20 kDa |
Target | ARF6 |
UniProt ID | P62330 |
Protein Sequence | Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG |
NCBI | NP_001654 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DKFZp564M0264 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target: ARF6, Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.
IHC Information: Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.
WB Suggested Anti-ARF6 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate. ARF6 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
FC, ICC, IF, IHC, WB | |
Bovine, Gallus, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating