You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330535 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ARF1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Yeast, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARF1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 21kDa |
Target | ARF1 |
UniProt ID | P61204 |
Protein Sequence | Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
NCBI | NP_001649 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PVNH8 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of mouse Brain lysate using ARF1 antibody
Immunoprecipitation of rat brain tissue using ARF1 antibody
Immunohistochemical staining of mouse brain tissue using ARF1 antibody
Western blot analysis of human Fetal Lung tissue using ARF1 antibody
Western blot analysis of human, mouse Brain tissue using ARF1 antibody
Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: ARF1, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: ARF1.
ARF1 antibody - middle region (orb330535) validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.
Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.
Sample Type:Mouse Brain lysate.
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating