You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1184754 |
---|---|
Category | Antibodies |
Description | AREB6/ZEB1 Antibody (monoclonal, 8B12D7) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 8B12D7 |
Tested applications | ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence of human AREB6/ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 200 kDa |
UniProt ID | P37275 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human glioblastoma tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human thyroid cancer tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human breast cancer tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of mouse brain tissue.
IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of rat brain tissue.
IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human glioma tissue.
IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in an immunocytochemical section of U87 cells.
Western blot analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating