ARC antibody

• Catalog Number: orb576004
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Goat, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45 kDa
• Target: ARC
• UniProt ID: Q7LC44
• Protein Sequence: Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
• NCBI: NP_056008
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: hArc, Arg3.1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.8 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: ARC, Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ARC, Sample Type: 293T, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ARC, Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: ARC, Sample Type: Hela, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target: ARC, Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Adrenal tissue at an antibody concentration of 5 ug/ml using anti-ARC antibody (orb576004).

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.