You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb308769 |
---|---|
Category | Antibodies |
Description | Aquaporin 2/AQP2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 28837 MW |
UniProt ID | P41181 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Aquaporin-2;AQP-2;ADH water channel;Aquaporin-CD;A Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of PC-3 cells using anti-AQP2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Lane 1:rat kidney tissue; 2:rat NRK cell; 3:rat PC-12 cell; 4:mouse kidney tissue; 5:mouse HBZY cell; 6:mouse RAW264.7 cell.
IHC analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Aquaporin 2 was detected in paraffin-embedded section of Human Renal Cancer Tissue.
IHC analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Aquaporin 2 was detected in paraffin-embedded section of Rat Kidney Tissue.
IHC analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Aquaporin 2 was detected in paraffin-embedded section of Mouse Kidney Tissue.
IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating