Apolipoprotein E protein

• Catalog Number: orb8242
• Category: Proteins
• Description: Mouse monoclonal antibody to Apolipoprotein E
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 38.6 kDa
• UniProt ID: P18287
• Protein Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
• Protein Length: Partial
• Source: E.coli
• Biological Origin: Oryctolagus cuniculus (Rabbit)
• Expression Region: 20-311aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE
• Note: For research use only
• Application notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 19-311aaSequence Info: Full LengthGlycerol content: 0.5
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.