You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333722 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Apolipoprotein E |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human APOE |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36 kDa |
Target | APOE |
UniProt ID | P02649 |
Protein Sequence | Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF |
NCBI | NP_000032 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of mouse brain tissue using Apolipoprotein E antibody
Immunohistochemical staining of human kidney tissue using Apolipoprotein E antibody
Immunohistochemical staining of human Adrenal tissue using Apolipoprotein E antibody
Immunohistochemical staining of human Liver tissue using Apolipoprotein E antibody
Western blot analysis of human Brain tissue using Apolipoprotein E antibody
Western blot analysis of human Fetal liver tissue using Apolipoprotein E antibody
25 ug of the indicated Human whole cell and tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Anti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
APOE antibody - N-terminal region (orb333722) validated by WB using Fetal liver cell lysate at 1 ug/ml.
APOE antibody - N-terminal region (orb333722), Catalog Number: orb333722, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and membrane of hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Host: Rabbit, Target Name: APOE, Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: APOE, Sample Tissue: Human Liver Tumor, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: APOE, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: NSUN6, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
IHC-P, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating