APOL2 antibody

• Catalog Number: orb330603
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APOL2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: APOL2
• UniProt ID: Q9BQE5
• Protein Sequence: Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD
• NCBI: NP_112092
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti APOL-II antibody, anti APOL3 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of MCF7 cell lysate tissue using APOL2 antibody

WB Suggested Anti-APOL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.