APOBEC3F antibody

• Catalog Number: orb577510
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOBEC3F
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3F
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: APOBEC3F
• UniProt ID: Q8IUX4
• Protein Sequence: Synthetic peptide located within the following region: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD
• NCBI: NP_660341
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: A3F, KA6, ARP8, BK150C2.4.MRNA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: APOBEC3F, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: APOBEC3F, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 4 ug/ml.

Host: Rabbit, Target Name: APOBEC3F, Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/ml.

Host: Rabbit, Target: APOBEC3F, Positive control (+): Human Spleen (SP), Negative control (-): SH-SY5Y Cell Lysate (N19), Antibody concentration: 1 ug/ml.

WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: OVCAR-3 cell lysate. APOBEC3F is supported by BioGPS gene expression data to be expressed in OVCAR3.