You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579676 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to APOBEC3B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46kDa |
Target | APOBEC3B |
UniProt ID | Q9UH17 |
Protein Sequence | Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW |
NCBI | NP_004891 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A3B, ARP4, ARCD3, PHRBNL, APOBEC1L, bK150C2.2, DJ7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: APOBEC3B, Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: APOBEC3B, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Host: Rabbit, Target: APOBEC3B, Positive control (+): Human Lung (LU), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 3 ug/ml.
WB Suggested Anti-APOBEC3B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, IF, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating