You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580319 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to APEH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human APEH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 81kDa |
Target | APEH |
UniProt ID | P13798 |
Protein Sequence | Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR |
NCBI | NP_001631 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | APH, OPH, AARE, ACPH, D3S48E, D3F15S2, DNF15S2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
APEH was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb580319 with 1:200 dilution. Western blot was performed using orb580319 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: APEH IP with orb580319 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Host: Mouse, Target Name: APEH, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: APEH, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Rabbit Anti-APEH Antibody, Catalog Number: orb580319, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-APEH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. APEH is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-APEH antibody Titration: 1 ug/ml, Sample Type: Human liver.
Filter by Rating