You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576071 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ANXA4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36 kDa |
Target | ANXA4 |
UniProt ID | Q6LES2 |
Protein Sequence | Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ |
NCBI | NP_001144 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-27 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein can be modified by acetylation and phosphorylation.
Host: Rabbit, Target Name: ANXA4, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: ANXA4, Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
Host: Rat, Target Name: ANXA4, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Human Intestine
WB Suggested Anti-ANXA4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Hamster, Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating