Anti-GFAP

• Catalog Number: orb382936
• Category: Antibodies
• Description: Goat polyclonal antibody to GFAP. Glial fibrillary acidic protein is a major intermediate filament protein of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 375 aa to the C-terminus of human GFAP produced in E. coli.. Antigen Sequence: ENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:500-1:5,000
• Conjugation: Unconjugated
• Target: Glial fibrillary acidic protein
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: ALXDRD, glial fibrillary acidic protein antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.