You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1728223 |
---|---|
Category | Antibodies |
Description | 0 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC, IHC-Fr, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 8 (410-449aa VSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYE), different from the related mouse and rat sequences by seven amino acids. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55391 MW |
UniProt ID | Q14790 |
Storage | At -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freezing and thawing. |
Alternative names | CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8, Caspase-8 Read more... |
Note | For research use only |
Application notes | Western blot, 0.1-0.5 μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/ml, Human, Mouse, Rat, By Heat Immunohistochemistry(Frozen Section), 0.5-1 μg/ml, Human Immunocytochemistry, 0.5-1 μg/ml, Human Flow Cytometry, 1-3 μg/1x10^6 cells, Human. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of PC-3 cells using anti-CASP8 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of HeLa cells using anti-CASP8 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Caspase8 using anti-Caspase8 antibody.Lane 1:rat liver tissue;2:mouse liver tissue;3:HEPG2 cell.
IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of mouse spleen tissues.
IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of rat intestine tissues.
IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of rat spleen tissues.
IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of human intestinal cancer tissues.
IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of human mammary cancer tissues.
Filter by Rating