Anti-BAX

• Catalog Number: orb334986
• Category: Antibodies
• Description: Goat polyclonal antibody to BAX. This protein belongs to the BCL2 protein family that act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The expression of BAX gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IF, IHC-Fr, IHC-P, WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli.. Antigen Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFF
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:500-1:5,000, IF:1:50-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Conjugation: Unconjugated
• Target: BCL2-associated X protein
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: BCL2-associated X protein antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

References

Juanjuan Xiong, Zixu Wang, Yulan Dong, Jing Cao, Yaoxing Chen The signal pathway of melatonin mediates the monochromatic light-induced T-lymphocyte apoptosis in chicken thymus Poult Sci, 103331 (2023)

PubMed: 38100948

Applications

WB

Reactivity

Gallus

Guo, Xuewen et al. Composite ammonium glycyrrhizin has hepatoprotective effects in chicken hepatocytes with lipopolysaccharide/enrofloxacin-induced injury Exp Ther Med, 20, 52 (2020)

PubMed: 32952642

Applications

WB

Reactivity

Gallus

Western blot analysis of staining of MDA-MB-231 lysates using BAX antibody

Immunofluorescence analysis of NHI/3T3 Cells using BAX antibody.