ANP32A antibody

• Catalog Number: orb577484
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ANP32A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANP32A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: ANP32A
• UniProt ID: P39687
• Protein Sequence: Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE
• NCBI: NP_006296
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LANP, MAPM, PP32, HPPCn, PHAP1, PHAPI, I1PP2A, C15
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: ANP32A.

Rabbit Anti-ANP32A antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-ANP32A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. ANP32A is supported by BioGPS gene expression data to be expressed in Jurkat.