Annexin A3 antibody

• Catalog Number: orb576014
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Annexin A3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Equine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36 kDa
• Target: ANXA3
• UniProt ID: P12429
• Protein Sequence: Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
• NCBI: NP_005130
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANX3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: ANXA3, Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target: ANXA3, Positive control (+): A549 (N03), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.

Human Spleen

WB Suggested Anti-ANXA3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.