ANKFY1 antibody

• Catalog Number: orb586584
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ANKFY1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANFY1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 128 kDa
• Target: ANKFY1
• UniProt ID: Q9P2R3
• Protein Sequence: Synthetic peptide located within the following region: TPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVS
• NCBI: XP_005256736.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANKHZN, BTBD23, ZFYVE14
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ANFY1, Sample Type: HCT116 Whole Cell, Antibody dilution: 1.0 ug/ml.