You have no items in your shopping cart.
Cart summary
ANGPT2 Protein
Catalog Number: orb1477706
| Catalog Number | orb1477706 |
|---|---|
| Category | Proteins |
| Description | Recombinant Dog Angiopoietin-2(ANGPT2) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 55.9 kDa |
| UniProt ID | A0A8J8 |
| Protein Sequence | YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Canis lupus familiaris (Dog) (Canis familiaris) |
| Expression Region | 19-495aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | (ANG-2) Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
- Item 1 of 2
Recombinant human Angiopoietin-2 protein, N-His-Avi (HEK293), Biotin conjugated [orb2328776]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
35 kDa
20 μg, 100 μg - Item 1 of 1
Human ANGPT2(275-496) Protein, His Tag [orb1743347]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 26.3 kDa after removal of the signal peptide. The apparent molecular mass of ANGPT2(275-496)-His is approximately 25-35 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human ANGPT2(19-496) Protein, His Tag [orb1743348]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 55.7 kDa after removal of the signal peptide. The apparent molecular mass of ANGPT2(19-496)-His is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
Human ANGPT2 Protein, hFc Tag [orb1291095]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 49.94 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg
