Angpt1 antibody

• Catalog Number: orb585529
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Angpt1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: Angpt1
• UniProt ID: Q8C2K6
• Protein Sequence: Synthetic peptide located within the following region: EFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHT
• NCBI: NP_033770
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: an, Ang, Ang1, Ang-1, 1110046O21Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Angpt1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.