Angiotensin Converting Enzyme 1/Ace Antibody

• Catalog Number: orb402336
• Category: Antibodies
• Description: Angiotensin Converting Enzyme 1/Ace Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 180 kDa
• UniProt ID: P09470
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Angiotensin-converting enzyme; ACE; Dipeptidyl car
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Ace using anti-Ace antibody.Lane 1:mouse lung tissue;2:mouse testis tissue;3:mouse stomach tissue;4:rat lung tissue.