You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402336 |
---|---|
Category | Antibodies |
Description | Angiotensin Converting Enzyme 1/Ace Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 180 kDa |
UniProt ID | P09470 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Angiotensin-converting enzyme; ACE; Dipeptidyl car Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Ace using anti-Ace antibody.Lane 1:mouse lung tissue;2:mouse testis tissue;3:mouse stomach tissue;4:rat lung tissue.
ICC, IF, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating